PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g103940.1
Common NameMTR_8g103940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family B3
Protein Properties Length: 499aa    MW: 57359.3 Da    PI: 9.5145
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g103940.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B352.11.2e-1639130199
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      ffk+  +s + + g l +p  f+++++g+   s  + l++++ ++Wev l  +kk+g +++ kGW+eF+    ++ g +++F+++++s f  ++
  Medtr8g103940.1  39 FFKIV-TSTNIQDGTLKIPDAFTKKYSGD--LSNPMFLKTPDDKKWEVHL--TKKDGDIWIHKGWNEFATHYSIDHGHMLMFQYEKTSHF--KI 125
                      66666.99999***************888..6667***************..********************************998999..88 PP

                      EEE-S CS
               B3  95 kvfrk 99 
                       +f+k
  Medtr8g103940.1 126 YIFNK 130
                      88876 PP

2B353.64.1e-17243331298
                      EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      f+v ++ ++ +++ +++p +f ++++++k++   ++l+   +gr+W+vk+  +++      ++GWk+F+ +n+Lk+gD+++F++++++   ++v
  Medtr8g103940.1 243 FTVVMT-YSYANKYMYIPVDFEQKYMKEKQS--VIVLQVlDNGRTWNVKH--WGRH----VSTGWKKFAFDNNLKVGDVCLFEMIKSNAYAFKV 327
                      555544.44455569*******999877655..4555554589*******..9987....677********************99877777788 PP

                      EEE- CS
               B3  95 kvfr 98 
                       +fr
  Medtr8g103940.1 328 LIFR 331
                      8887 PP

3B344.82.3e-144184941797
                      E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
               B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      ++ ++f e++     ++k+++  + + + W v+l  + +  ++ l++GW++Fv++n+L++gD++vF+l+++++  +  ++f
  Medtr8g103940.1 418 RIHNSFSEKYL----CHKKIVTLQFNKNLWHVRLASCPSEPSTKLSTGWSKFVEENKLEAGDVCVFELVNKEDLVFDAHIF 494
                      46666666663....667899999999*******88888888**************************9878876666666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.75E-2036131IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.39438131IPR003340B3 DNA binding domain
CDDcd100176.26E-1538129No hitNo description
SMARTSM010193.8E-1439131IPR003340B3 DNA binding domain
PfamPF023629.0E-1539130IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.7E-2139131IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.9E-22235331IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-22237332IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.775241333IPR003340B3 DNA binding domain
CDDcd100171.70E-19241331No hitNo description
SMARTSM010198.2E-13242333IPR003340B3 DNA binding domain
PfamPF023625.7E-14243331IPR003340B3 DNA binding domain
SMARTSM010191.2E-5394495IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.0E-18397495IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-17399497IPR015300DNA-binding pseudobarrel domain
CDDcd100177.17E-15401495No hitNo description
PfamPF023629.3E-13419495IPR003340B3 DNA binding domain
PROSITE profilePS5086311.533443497IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MPPMHRKGDR SVSINTIHHN SEDLSMTCNP RNMHSFIRFF KIVTSTNIQD GTLKIPDAFT  60
KKYSGDLSNP MFLKTPDDKK WEVHLTKKDG DIWIHKGWNE FATHYSIDHG HMLMFQYEKT  120
SHFKIYIFNK STLEIEYHVD GNNQHEQNNL VENLDEKPTC KKTRPKSQIS SLQPHKKSRI  180
GASKDVGTSS KLKKNPKLVQ VKEESEDTTE CLNVNDQEPK NSTSKIAEAL NKAKNYKTNN  240
PFFTVVMTYS YANKYMYIPV DFEQKYMKEK QSVIVLQVLD NGRTWNVKHW GRHVSTGWKK  300
FAFDNNLKVG DVCLFEMIKS NAYAFKVLIF RLGEEHSLPP QVHGDGVNWV ETARIPGVEC  360
KTMSYKGKKA TQNSLHASSC SFKSSEVKKE SDQFASTLKN PHFTIKVISS HADVYKPRIH  420
NSFSEKYLCH KKIVTLQFNK NLWHVRLASC PSEPSTKLST GWSKFVEENK LEAGDVCVFE  480
LVNKEDLVFD AHIFRGCN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A9e-1722933435144B3 domain-containing transcription factor VRN
4i1k_B9e-1722933435144B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1454490.0AC145449.8 Medicago truncatula clone mth2-20m15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003630835.10.0transcriptional factor B3 family protein
TrEMBLG7L9110.0G7L911_MEDTR; Transcriptional factor B3 family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-47B3 family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]